CYB561 antibody (Middle Region)

Catalog No. ABIN636106

This Rabbit Polyclonal antibody specifically detects CYB561 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CYB561 antibody (Middle Region) (ABIN636106)

Target: CYB561 (Cytochrome B-561 (CYB561))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYB561 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CYB561 Antibody

Binding Specificity: Middle Region

Specificity: CYB561 antibody was raised against the middle region of CYB561

Purification: Affinity purified

Immunogen: CYB561 antibody was raised using the middle region of CYB561 corresponding to a region with amino acids LFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGGKYSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYB561 Blocking Peptide, (ABIN940329), is also available for use as a blocking control in assays to test for specificity of this CYB561 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYB561 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYB561

Target: CYB561 (Cytochrome B-561 (CYB561))

Alternative Name: CYB561

Background: CYB561 is a senescene-associated protein in normal human oral keratinocytes.

Molecular Weight: 27 kDa (MW of target protein)