SLC20A2 antibody

Catalog No. ABIN636107

The Rabbit Polyclonal anti-SLC20A2 antibody has been validated for WB. It is suitable to detect SLC20A2 in samples from Human, Mouse, Rat and Dog.

Quick Overview for SLC20A2 antibody (ABIN636107)

Target: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC20A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC20A2 Antibody

Purification: Affinity purified

Immunogen: SLC20 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC20A2 Blocking Peptide, (ABIN937607), is also available for use as a blocking control in assays to test for specificity of this SLC20A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC20A2

Target: SLC20A2 (Solute Carrier Family 20 (Phosphate Transporter), Member 2 (SLC20A2))

Alternative Name: SLC20A2

Background: SLC20A2 is a sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. It may play a role in extracellular matrix, cartilage and vascular calcification.

Molecular Weight: 70 kDa (MW of target protein)