SLC19A3 antibody (Middle Region)

Catalog No. ABIN636108

This anti-SLC19A3 antibody is a Rabbit Polyclonal antibody detecting SLC19A3 in WB. Suitable for Human and Mouse.

Quick Overview for SLC19A3 antibody (Middle Region) (ABIN636108)

Target: SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC19A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC19A3 Antibody

Binding Specificity: Middle Region

Specificity: SLC19 A3 antibody was raised against the middle region of SLC19 3

Purification: Affinity purified

Immunogen: SLC19 A3 antibody was raised using the middle region of SLC19 3 corresponding to a region with amino acids FATAGFNQVLNYVQILWDYKAPSQDSSIYNGAVEAIATFGGAVAAFAVGY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC19A3 Blocking Peptide, (ABIN938234), is also available for use as a blocking control in assays to test for specificity of this SLC19A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC19A3

Target: SLC19A3 (Slc19a3) (Solute Carrier Family 19, Member 3 (Slc19a3))

Alternative Name: SLC19A3

Background: SLC19A3 mediates high affinity thiamine uptake, propably via a proton anti-port mechanism. SLC19A3 has no folate transport activity.SLC19A3 is a member of the reduced folate family of micronutrient transporter genes.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport