FAAH2 antibody (C-Term)
-
- Target See all FAAH2 Antibodies
- FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))
-
Binding Specificity
- C-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAAH2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAAH2 antibody was raised against the C terminal of FAAH2
- Purification
- Affinity purified
- Immunogen
- FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE
- Top Product
- Discover our top product FAAH2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAAH2 Blocking Peptide, catalog no. 33R-8683, is also available for use as a blocking control in assays to test for specificity of this FAAH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAAH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))
- Alternative Name
- FAAH2 (FAAH2 Products)
- Background
- Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.
- Molecular Weight
- 58 kDa (MW of target protein)
-