FAAH2 antibody (C-Term)

Catalog No. ABIN636114

The Rabbit Polyclonal anti-FAAH2 antibody (ABIN636114) specifically detects FAAH2 in WB. The antibody is reactive with Human samples.

Quick Overview for FAAH2 antibody (C-Term) (ABIN636114)

Target: FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAAH2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAAH2 Antibody

Binding Specificity: C-Term

Specificity: FAAH2 antibody was raised against the C terminal of FAAH2

Purification: Affinity purified

Immunogen: FAAH2 antibody was raised using the C terminal of FAAH2 corresponding to a region with amino acids SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAAH2 Blocking Peptide, (ABIN5613444), is also available for use as a blocking control in assays to test for specificity of this FAAH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAAH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAAH2

Target: FAAH2 (Fatty Acid Amide Hydrolase 2 (FAAH2))

Alternative Name: FAAH2

Background: Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.

Molecular Weight: 58 kDa (MW of target protein)