ACTN3 antibody

Catalog No. ABIN6654015

This Mouse Monoclonal antibody specifically detects ACTN3 in WB and IHC (p). It exhibits reactivity toward Mouse and Rat.

Quick Overview for ACTN3 antibody (ABIN6654015)

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Reactivity: Mouse, Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This ACTN3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 9B5

Product Details anti-ACTN3 Antibody

Purification: Protein G affinity

Immunogen: Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK were used as the immunogen for the ACTN3 antibody.

Isotype: IgG1

Application Details

Application Notes: Optimal dilution of the ACTN3 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ACTN3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Alternative Name: ACTN3 / Alpha Actinin 3

Background: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

UniProt: Q08043

Pathways: Cell-Cell Junction Organization