PTH antibody (AA 1-38)

Catalog No. ABIN6757888

The Mouse Monoclonal anti-PTH antibody has been validated for IHC, ELISA, IHC (p), ICC, RIA and IHC (fro). It is suitable to detect PTH in samples from Human and Monkey.

Quick Overview for PTH antibody (AA 1-38) (ABIN6757888)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: Immunohistochemistry (IHC), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunocytochemistry (ICC), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: B1-70

Product Details anti-PTH Antibody

Binding Specificity: AA 1-38

Specificity: Recognizes human PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84) There were no cross reactivities obtained with synthetic human PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1-86).

Predicted Reactivity: Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%) Horse (97%) Elephant, Panda, Dog, Pig (94%) Bovine (90%) Hamster, Cat (87%) Rat (84%) Mouse (81%).

Purification: Immunoaffinity purified

Immunogen: Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%), Horse (97%), Elephant, Panda, Dog, Pig (94%), Bovine (90%), Hamster, Cat (87%), Rat (84%), Mouse (81%).

Isotype: IgG1

Application Details

Application Notes: Approved: ELISA (1 μg/mL), ICC (2 μg/mL), IHC, IHC-Fr, IHC-P, RIA

Usage: Suitable for use in ELISA, RIA, Immunocytochemistry. ELISA: 1 μg/mL. RIA: 25 ng/mL. Immunocytochemistry: 2 μg/mL. Frozen, paraffin.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from in 50 mM Tris,  pH 7.2

Storage: 4 °C,-20 °C

Storage Comment: Lyophilized powder may be stored at 4°C for short-term only. Reconstituted product is stable for 1 year at -20°C.

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone / PTH

Target Type: Hormone

Background: Name/Gene ID: PTH
Family: Hormone

Synonyms: PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1

Gene ID: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process