CD68 antibody (AA 27-282)
Quick Overview for CD68 antibody (AA 27-282) (ABIN7442816)
Target
See all CD68 AntibodiesReactivity
Host
Clonality
Conjugate
Application
-
-
Binding Specificity
- AA 27-282
-
Purpose
- Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1)
-
Specificity
- The antibody is a rabbit polyclonal antibody raised against SCARD1. It has been selected for its ability to recognize SCARD1 in immunohistochemical staining and western blotting.
-
Purification
- Antigen-specific affinity chromatography followed by Protein A affinity chromatography
-
Immunogen
- Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag
-
Isotype
- IgG
-
-
-
-
Application Notes
- Western blotting: 0.01-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.
-
Comment
-
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
-
Restrictions
- For Research Use only
-
-
-
Format
- Liquid
-
Concentration
- 0.5 mg/mL
-
Buffer
- PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.
-
Preservative
- Sodium azide
-
Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Storage
- 4 °C,-20 °C
-
Storage Comment
- Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
-
Expiry Date
- 24 months
-
-
- CD68 (CD68 Molecule (CD68))
-
Alternative Name
- SCARD1
-
Background
- CD68, GP110, Macrosialin, Macrophage Antigen CD68
-
UniProt
- P31996
Target
-