PPP1R8 antibody

Catalog No. ABIN7272976

The Goat Polyclonal anti-PPP1R8 antibody (ABIN7272976) specifically detects PPP1R8 in WB. The antibody is reactive with Archaeoprepona samples.

Quick Overview for PPP1R8 antibody (ABIN7272976)

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reactivity: Archaeoprepona

Host: Goat

Clonality: Polyclonal

Conjugate: This PPP1R8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPP1R8 Antibody

Cross-Reactivity (Details): Archeoprepona genus

Purification: Epitope affinity purified

Immunogen: Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli

Isotype: IgG

Application Details

Application Notes: WB:1:500-1:2,000

Comment:

Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin

Restrictions: For Research Use only

Handling

Concentration: 2 mg/mL

Buffer: PBS, 20 % glycerol and 0.05 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: Store at -20 °C for long-term storage. Store at 2-8 °C for up to one month.

Target Details for PPP1R8

Target: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Alternative Name: ARD1