Ataxin 1 antibody (AA 164-197) (FL550)

Catalog No. ABIN7595560

This anti-Ataxin 1 antibody is a Mouse Monoclonal antibody detecting Ataxin 1 in IHC and ICC. Suitable for Mouse.

Quick Overview for Ataxin 1 antibody (AA 164-197) (FL550) (ABIN7595560)

Target: Ataxin 1 (ATXN1)

Reactivity: Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This Ataxin 1 antibody is conjugated to FL550

Application: Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Grade: KO Validated

Clone: N76-8

Product Details anti-Ataxin 1 Antibody (FL550)

Binding Specificity: AA 164-197

Purpose: Anti-Ataxin-1, 11NQ Antibody FL550 Conjugate

Sequence: ATTPSQRSQL EAYSTLLANM GSLSQAPGHK VEPP

Specificity: No off-targets reported

Cross-Reactivity: Human, Rat

Characteristics: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.

Purity: Purified mAbs are >90 % specific antibody.

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)

Isotype: IgG2b

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: PBS with 0.09 % azide7.4

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Expiry Date: 12 months

Target Details for Ataxin 1

Target: Ataxin 1 (ATXN1)

Alternative Name: Ataxin-1

Background:

Synonyms: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)

Description Logic: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Gene Name Alternatives: Atxn1 Sca1

Molecular Weight: 85 kDa

UniProt: P54254

Pathways: Synaptic Membrane