SARS-CoV-2 ORF8 antibody

Catalog No. ABIN7603757

This anti-SARS-CoV-2 ORF8 antibody is a Rabbit Polyclonal antibody detecting SARS-CoV-2 ORF8 in ELISA. Suitable for Human.

Quick Overview for SARS-CoV-2 ORF8 antibody (ABIN7603757)

Target: SARS-CoV-2 ORF8

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SARS-CoV-2 ORF8 antibody is un-conjugated

Application: ELISA

Product Details anti-SARS-CoV-2 ORF8 Antibody

Purpose: Anti-SARS-CoV-2 ORF8 Antibody

Sequence: AAFHQECSLQ SCTQHQPYVV DDPCPIHFYS KWYIRVGARK SAPLIELCVD EAGSKSPIQY IDIGNYTVSC LPFTINCQEP KLGSLVVRCS FYEDFLEYHD VRVVLDFI

Characteristics: Anti-SARS-CoV-2 ORF8 Antibody (ABIN7603757). Tested in ELISA applications. This antibody reacts with Human.

Purification: Immunogen affinity purified.

Immunogen: AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Isotype: IgG

Application Details

Application Notes: ELISA, 0.001-0.1 μg/mL, Human1. Gordon DE, et al. Nature, 2020 Jul. 2. Gordon DE, et al. Science, 2020 Oct 15. 3. Li JY, et al. Virus Res, 2020 Sep. 4. Wu F, et al. Nature, 2020 Mar.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Storage: 4 °C,-20 °C

Storage Comment: Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Details for SARS-CoV-2 ORF8

Target: SARS-CoV-2 ORF8

Background:

Synonyms: ORF8 protein, ORF8, Non-structural protein 8, ns8

Tissue Specificity: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. .

Background: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.

Molecular Weight: 140 kDa, 130 kDa, 110 kDa

Gene ID: 43740577