EXT1 antibody

Catalog No. ABIN7616846

The Mouse Monoclonal anti-EXT1 antibody has been validated for WB, IHC, IP and ICC. It is suitable to detect EXT1 in samples from Various Species.

Quick Overview for EXT1 antibody (ABIN7616846)

Target: EXT1 (Exostosin 1 (EXT1))

Reactivity: Various Species

Host: Mouse

Clonality: Monoclonal

Conjugate: This EXT1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Clone: C2

Product Details anti-EXT1 Antibody

Purpose: Exenatide (EXT) Monoclonal Antibody

Characteristics: The Exenatide (EXT) Monoclonal Antibody (Species: Universal) has been validated for the following applications: WB, IHC, ICC, IP.

Purification: Protein A + Protein G affinity chromatography

Immunogen: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Isotype: IgG2a kappa

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: 0.01M PBS, pH 7.4, containing 0.05 % Proclin-300, 50 % glycerol

Preservative: ProClin

Precaution of Use: This product contains ProClin: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: 2°C to 8°C for frequent use, -20°C for 12 months. Avoid repeated freeze/thaw cycles.

Expiry Date: 12 months

Target Details for EXT1

Target: EXT1 (Exostosin 1 (EXT1))

Alternative Name: EXT

UniProt: P26349

Pathways: Glycosaminoglycan Metabolic Process