Ataxin 1 antibody (AA 164-197)

Catalog No. ABIN7823056

This Mouse Monoclonal antibody specifically detects Ataxin 1 in WB, IHC, ELISA and ICC. It exhibits reactivity toward Mouse.

Quick Overview for Ataxin 1 antibody (AA 164-197) (ABIN7823056)

Target: Ataxin 1 (ATXN1)

Reactivity: Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This Ataxin 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunocytochemistry (ICC)

Grade: Carrier-free

Clone: N76-8

Product Details anti-Ataxin 1 Antibody

Binding Specificity: AA 164-197

Purpose: Anti-Ataxin-1, 11NQ Antibody (BSA and Azide free)

Sequence: ATTPSQRSQL EAYSTLLANM GSLSQAPGHK VEPP

Specificity: No off-targets reported

Cross-Reactivity: Human, Rat

Characteristics: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced in-house from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, ELISA.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.

Purity: Purified mAbs are >90 % specific antibody.

Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse ataxin-1 (accession number P54254)

Isotype: IgG2b

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS7.4, carrier free

Preservative: Azide free

Handling Advice: For maximum recovery of product, centrifuge the vial prior to removing the cap.

Storage: 4 °C,-20 °C

Storage Comment: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C.

Expiry Date: 12 months

Target Details for Ataxin 1

Target: Ataxin 1 (ATXN1)

Alternative Name: Ataxin-1

Background:

Synonyms: Ataxin-1 (Spinocerebellar ataxia type 1 protein homolog)

Description Logic: Our Anti-Ataxin-1, 11NQ mouse monoclonal primary antibody is produced from hybridoma clone N76/8. It is KO validated, detects human, mouse, and rat Ataxin-1, 11NQ, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, ELISA.

Gene Name Alternatives: Atxn1 Sca1

Molecular Weight: 85 kDa

UniProt: P54254

Pathways: Synaptic Membrane