Actin-Like 6B antibody (AA 39-114)

Catalog No. ABIN7823678

The Mouse Monoclonal anti-Actin-Like 6B antibody has been validated for WB, IHC, ELISA and ICC. It is suitable to detect Actin-Like 6B in samples from Human.

Quick Overview for Actin-Like 6B antibody (AA 39-114) (ABIN7823678)

Target: Actin-Like 6B (ACTL6B)

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This Actin-Like 6B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA, Immunocytochemistry (ICC)

Grade: Carrier-free

Clone: N332B-15

Product Details anti-Actin-Like 6B Antibody

Binding Specificity: AA 39-114

Purpose: Anti-BAF53b Antibody (BSA and Azide free)

Sequence: TTVGLLAAEE GGGLELEGDK EKKGKIFHID TNALHVPRDG AEVMSPLKNG MIEDWECFRA ILDHTYSKHV KSEPNL

Specificity: No off-targets reported for BAF53a

Cross-Reactivity: Mouse

Characteristics: Our Anti-BAF53b mouse monoclonal primary antibody is produced in-house from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, ELISA.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.

Purity: Purified mAbs are >90 % specific antibody.

Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (accession number O94805) produced recombinantly in E. Coli

Isotype: IgG1

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS7.4, carrier free

Preservative: Azide free

Handling Advice: For maximum recovery of product, centrifuge the vial prior to removing the cap.

Storage: 4 °C,-20 °C

Storage Comment: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C.

Expiry Date: 12 months

Target Details for Actin-Like 6B

Target: Actin-Like 6B (ACTL6B)

Alternative Name: BAF53b

Background:

Synonyms: Actin-like protein 6B (53 kDa BRG1-associated factor B) (Actin-related protein Baf53b) (ArpNalpha) (BRG1-associated factor 53B) (BAF53B)

Description Logic: Our Anti-BAF53b mouse monoclonal primary antibody is produced from hybridoma clone N332B/15. It is KO validated, detects human and mouse BAF53b, and is purified by protein a chromatography. It is great for use in WB, IHC, ICC, ELISA.

Gene Name Alternatives: ACTL6B ACTL6 BAF53B

Molecular Weight: 53 kDa

UniProt: O94805