Receptor Accessory Protein 1 antibody (C-Term, Cytosolic) (FL650)

Catalog No. ABIN7823692

This Mouse Monoclonal antibody specifically detects Receptor Accessory Protein 1 in IHC and ICC. It exhibits reactivity toward Mouse.

Quick Overview for Receptor Accessory Protein 1 antibody (C-Term, Cytosolic) (FL650) (ABIN7823692)

Target: Receptor Accessory Protein 1 (REEP1)

Reactivity: Mouse

Host: Mouse

Clonality: Monoclonal

Conjugate: This Receptor Accessory Protein 1 antibody is conjugated to FL650

Application: Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Clone: N345-51

Product Details anti-Receptor Accessory Protein 1 Antibody (FL650)

Binding Specificity: AA 111-201, C-Term, Cytosolic

Purpose: Anti-REEP1 Antibody FL650 Conjugate

Sequence: KDRSYDALVH FGKRGLNVAA TAAVMAASKG QGALSERLRS FSMQDLTTIR GDGAPAPSGP PPPGTGRSSG KHSQPKMSRS ASESAGSSGT A

Specificity: No off-targets reported for REEP2

Cross-Reactivity: Rat

Characteristics: Our Anti-REEP1 mouse monoclonal primary antibody is produced in-house from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and conjugation of purified mAb. Purified mAbs are >90% specific antibody.

Purity: Purified mAbs are >90 % specific antibody.

Immunogen: Fusion protein amino acids 111-201 (KDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA, cytoplasmic C-terminus) of mouse REEP1 (accession number Q8BGH4) produced recombinantly in E. Coli

Isotype: IgG2b

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: PBS with 0.09 % azide7.4

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: For maximum recovery of product, centrifuge the vial prior to removing the cap.

Storage: 4 °C,-20 °C

Storage Comment: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C.

Expiry Date: 12 months

Target Details for Receptor Accessory Protein 1

Target: Receptor Accessory Protein 1 (REEP1)

Alternative Name: REEP1

Background:

Synonyms: Receptor expression-enhancing protein 1 (Spastic paraplegia 31 protein)

Description Logic: Our Anti-REEP1 mouse monoclonal primary antibody is produced from hybridoma clone N345/51. It detects mouse and rat REEP1, and is purified by protein a chromatography. It is great for use in IHC, ICC.

Gene Name Alternatives: Reep1 D6Ertd253e C2orf23 SPG31

Molecular Weight: 22 kDa

UniProt: Q8BGH4