SVOP antibody (Cytosolic, N-Term)

Catalog No. ABIN7823798

The Mouse Monoclonal anti-SVOP antibody has been validated for WB, ELISA and ICC. It is suitable to detect SVOP in samples from Rat.

Quick Overview for SVOP antibody (Cytosolic, N-Term) (ABIN7823798)

Target: SVOP (Synaptic Vesicle 2-Related Protein (SVOP))

Reactivity: Rat

Host: Mouse

Clonality: Monoclonal

Conjugate: This SVOP antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Immunocytochemistry (ICC)

Grade: Carrier-free

Clone: N356-23

Product Details anti-SVOP Antibody

Binding Specificity: AA 1-85, Cytosolic, N-Term

Purpose: Anti-SVOP Antibody (BSA and Azide free)

Sequence: MEEDLFQLRQ LPVVKFRRTG ESARSEDDAA SGEHDVQIEG VRVGLEAVEL DDGAAVPKEF ANPTDDTFMV EDAVEAIGFG RFQWK

Specificity: No off-targets reported for SVOPL/SVOP2

Cross-Reactivity: Mouse

Characteristics: Our Anti-SVOP mouse monoclonal primary antibody is produced in-house from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by protein a chromatography. It is great for use in WB, ICC, ELISA.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography and buffer exchanged into 1X PBS. Purified mAbs are >90% specific antibody.

Purity: Purified mAbs are >90 % specific antibody.

Immunogen: Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (accession number Q9Z2I7) produced recombinantly in E. Coli

Isotype: IgG1

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS7.4, carrier free

Preservative: Azide free

Handling Advice: For maximum recovery of product, centrifuge the vial prior to removing the cap.

Storage: 4 °C,-20 °C

Storage Comment: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C.

Expiry Date: 12 months

Target Details for SVOP

Target: SVOP (Synaptic Vesicle 2-Related Protein (SVOP))

Alternative Name: SVOP

Background:

Synonyms: Synaptic vesicle 2-related protein (SV2-related protein)

Description Logic: Our Anti-SVOP mouse monoclonal primary antibody is produced from hybridoma clone N356/23. It is KO validated, detects mouse and rat SVOP, and is purified by protein a chromatography. It is great for use in WB, ICC, ELISA.

Gene Name Alternatives: Svop

Molecular Weight: 60 kDa

UniProt: Q9Z2I7