HMGB3 antibody

Catalog No. ABIN7881047

This Mouse Monoclonal antibody specifically detects HMGB3 in WB, IHC (p), IF and FACS. It exhibits reactivity toward Human.

Quick Overview for HMGB3 antibody (ABIN7881047)

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This HMGB3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 7G13

Product Details anti-HMGB3 Antibody

Purpose: HMGB3 Antibody / HMG4

Sequence: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Purification: Affinity purified

Immunogen: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMGB3 antibody.

Isotype: IgG2b

Application Details

Application Notes: Optimal dilution of the HMGB3 antibody should be determined by the researcher.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: 4 °C,-20 °C

Storage Comment: After reconstitution, the HMGB3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Target Details for HMGB3

Target: HMGB3 (High Mobility Group Box 3 (HMGB3))

Alternative Name: HMGB3

Background: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

UniProt: O15347