PTH antibody (AA 1-34)

Catalog No. ABIN870737

The Goat Polyclonal anti-PTH antibody has been validated for RIA. It is suitable to detect PTH in samples from Human.

Quick Overview for PTH antibody (AA 1-34) (ABIN870737)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This PTH antibody is un-conjugated

Application: Radioimmunoassay (RIA)

Product Details anti-PTH Antibody

Binding Specificity: AA 1-34

Specificity: Human PTH (aa 12-17, 1-34, 1-38, 1-84)

Purification: Protein G purified

Immunogen: Synthetic human PTH (aa 1-34), bTG- conjugated (SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF),

Isotype: IgG

Application Details

Application Notes: RIA (1:30,000)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Buffer: IgG in PBS

Storage: 4 °C

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone

Target Type: Hormone

Background: LocusID: 5741

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process