Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CYP1A2 antibody (Cytochrome P450, Family 1, Subfamily A, Polypeptide 2) (AA 211-310) Primary Antibody

CYP1A2 Reactivity: Human IF, ELISA, WB Host: Mouse Monoclonal 4B3 unconjugated
Catalog No. ABIN947768
$524.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    CYP1A2
    Binding Specificity
    • 16
    • 11
    • 10
    • 8
    • 8
    • 4
    • 4
    • 4
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 211-310
    Reactivity
    • 75
    • 42
    • 26
    Human
    Host
    • 59
    • 17
    • 8
    Mouse
    Clonality
    • 70
    • 14
    Monoclonal
    Conjugate
    • 42
    • 8
    • 6
    • 5
    • 4
    • 3
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This CYP1A2 antibody is un-conjugated
    Application
    • 59
    • 42
    • 31
    • 22
    • 22
    • 13
    • 13
    • 9
    • 7
    • 4
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Immunofluorescence (IF), ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant CYP1A2.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: CYP1A2 (NP_000752, 211 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGNLIPQEKIVNL

    Clone
    4B3
    Isotype
    IgG3 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    CYP1A2
    Alternative Name
    CYP1A2 (CYP1A2 Antibody Abstract)
    Synonyms
    CP12, P3-450, P450(PA), CYP1A2, CYPIA2, P450-PM4, Cyp1a1, P450-3, CYPD45, P-450d, RATCYPD45, CYP1A5, CP450, CYP-IA2, cytochrome P450 family 1 subfamily A member 2, cytochrome P450 1A2, cytochrome P450 LM4, cytochrome P450, family 1, subfamily A, polypeptide 2, cytochrome P450, family 1, subfamily a, polypeptide 2, cytochrome P450 1A2-like, CYP1A2, LOC100328937, Cyp1a2, VDBG_06455, LOC101825565, LOC102130662
    Background
    Full Gene Name: cytochrome P450, family 1, subfamily A, polypeptide 2
    Synonyms: CP12,P3-450,P450(PA)
    Gene ID
    1544
    NCBI Accession
    NP_000752, NM_000761
You are here:
help Support