Dual Specificity Phosphatase 19 (DUSP19) Peptide
-
- Target See all DUSP19 products
- DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))
- Peptide Type
- Synthetic
- Origin
- Mammalian
-
Source
- Synthetic
- Application
- Blocking Peptide (BP), Western Blotting (WB), Immunohistochemistry (IHC)
- Sequence
- MHSLNQEIKAFSRDNLRKQCTRVTTLTGKKLIETWKDATV HVVETETSGG
- Characteristics
-
A synthetic peptide for use as a blocking control in assays to test for specificity of Dusp19 antibody,
Alternative Names: Dusp19 control peptide, Dusp19 antibody Blocking Peptide, Anti-Dusp19 Blocking Peptide, dual specificity phosphatase 19 Blocking Peptide, Dusp19, Dusp-19, Dusp 19, Dusp-19 Blocking Peptide, Dusp 19 Blocking Peptide
-
-
- Application Notes
- Optimal conditions should be determined by the investigator
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 100 µL of distilled water for a final peptide concentration is 1 mg/mL.
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- -20 °C
- Storage Comment
- Store at -20 °C long term.
-
- Target
- DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))
- Background
- Dusp19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.
- Molecular Weight
- 24 kDa
-