VAPB Protein (AA 1-222) (His tag)

Catalog No. ABIN667277

Product Details

Target: VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))

Protein Type: Recombinant

Protein Characteristics: AA 1-222

Origin: Human

Source: Escherichia coli (E. coli)

Purification tag / Conjugate: This VAPB protein is labelled with His tag.

Application: SDS-PAGE (SDS)

Sequence: MGSSHHHHHHSSGLVPRGSHMAKVEQVLSLEPQHELKFRG PFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTS DMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKI ISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEV QRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGL ST

Characteristics: VAPB, 1-222aa, Human, His tag, E.coli

Purity: > 90 % by SDS - PAGE

Application Details

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1.0 mg/ml (determined by Bradford assay)

Buffer: Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol

Storage: 4 °C

Target Details

Target: VAPB (VAMP (Vesicle-Associated Membrane Protein)-Associated Protein B and C (VAPB))

Alternative Name: VAPB (VAPB Products)

Background: VAPB, also known as vesicle-associated membrane protein (VAMP)-associated protein B, is a type IV transmembrane protein and member of the VAP family of proteins. This protein may play a role in vesicle trafficking. It is found in plasma and intracellular vesicle membranes as a homodimer and heterodimer with VAPA, and interacts with VAMP1 and VAMP2. Defects in VAPB are a cause of amyotrophic lateral sclerosis type 8 and spinal muscular atrophy autosomal dominant Finkel type. Recombinant human VAPB protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography. Synonyms: Vesicle-associated membrane protein-associated protein B/C, ALS8, VAMP-B, VAMP-C, VAP-B, VAP-C. NCBI no.: NP_004729

Molecular Weight: 27.1 kDa (242aa) confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)

Pathways: ER-Nucleus Signaling