Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Defensin, beta 4A (DEFB4A) (AA 4-41) antibody
| Antigen | Defensin, beta 4A (DEFB4A) |
| Synonyms |
SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEF ...
show more
|
| Epitope |
 Alternatives AA 4-41 |
| Clonality | Monoclonal (L12-4C-C2) |
| Host |
Alternatives Mouse |
| Reactivity |
Alternatives Human |
| Application |
Alternatives ELISA
|
| Catalog no. | ABIN109995 |
| Quantity | 10 µg (Variants) |
| Price | 166.40 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 3 to 5 Business days |
Additional Information
| Alternative name | beta-Defensin 2 (aa 4-41) |
| Immunogen | Synthetic human 61538-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP) |
| Isotype | IgG1 (Matching secondary antibodies) |
| Clone | L12-4C-C2 |
| Description | Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4 |
| Specificity | Synthetic human 61538-Defensin 2 (aa 4-41) |
| Synonyms | SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2 |
Application Details
| Application Notes | ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls. |
| Storage | 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided |
| Research Area | Immunology |
| Restrictions | For Research Use only |
Alternatives
Alternatives for antigen "Defensin, beta 4A (DEFB4A)", type "Antibodies"
| Hosts | Rabbit (20), Mouse (11), Sheep (8), Goat (7) |
| Reactivities | Human (30), Rat (Rattus) (16), Cow (Bovine) (1), Mouse (Murine) (1) |
| Applications | Western Blotting (WB) (21), ELISA (17), Enzyme Immunoassay (EIA) (15), Immunofluorescence (IF) (14), Flow Cytometry (FACS) (13), Radioimmunoassay (RIA) (5), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunoprecipitation (IP) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (EM) (1) |
| Conjugates | Biotin (4), Alexa Flour 488 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1), RBITC (1) |
| Epitopes | AA 4-41 (12), AA 3-39 (5) |
