HOXC4 antibody (N-Term)
-
- Target See all HOXC4 Antibodies
- HOXC4 (Homeobox C4 (HOXC4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Zebrafish (Danio rerio), Dog, Cow
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HOXC4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Sequence
- MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ
- Cross-Reactivity (Details)
- Species reactivity (expected):Mouse, Rat, Dog, Zebrafish, BovineSpecies reactivity (tested):Human
- Purification
- Purified on Protein A affinity column.
- Immunogen
- The immunogen for anti-HOXC4 antibody: synthetic peptide directed towards the N terminal of human HOXC4.
- Top Product
- Discover our top product HOXC4 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Reconstitution
- Add 100 μL of distilled water
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.
- Expiry Date
- 12 months
-
- Target
- HOXC4 (Homeobox C4 (HOXC4))
- Alternative Name
- HOXC4 / HOX3E (HOXC4 Products)
- Synonyms
- HOXC4 antibody, Hox3r3 antibody, hoxc4 antibody, z-96 antibody, zgc:110513 antibody, HOX3 antibody, HOX3E antibody, cp19 antibody, Hox-3.5 antibody, homeobox C4 antibody, homeo box C4 antibody, homeobox C4a antibody, hoxc4 antibody, HOXC4 antibody, Hoxc4 antibody, hoxc4a antibody
- Background
- HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5' non-coding exon.Synonyms: CP19, Homeobox protein Hox-C4, Hox-3E
- Gene ID
- 3221
- NCBI Accession
- NP_705897
-