Did you know that you can buy products from over 140 different suppliers from us?

RNA Binding Motif Protein 10 (RBM10) (N-Term) antibody

Details for Product No. ABIN182333
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E430039K10Rik, DXS8237E, GPATC9, GPATCH9, S1-1, TARPS, ZRANB5, RBM10
Epitope
N-Term
(11), (8), (3), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Human
(23), (4), (3)
Host
Rabbit
(20), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (11), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182333
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RBM10
Sequence MDYRSYPREYGSQEGKHDYDDSSEEQSAEDSYEASPGSET QRRRRRRHRH
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 90 %, Pig : 90 %, Rabbit : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against RBM10. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name RBM10
Background RBM10 contains RNA recognition motif found in a variety of RNA binding proteins, including various hnRNP proteins, proteins implicated in regulation of alternative splicing, and protein components of snRNPs. In vitro studies showed that the rat homolog bound to RNA homopolymers, with a preference for G and U polyribonucleotides. This gene is part of a gene cluster on chromosome Xp11.23, and its 3' end lies within 20 kb upstream of UBE1.
Molecular Weight 104 kDa
Gene ID 8241
NCBI Accession NM_005676, NP_005667
UniProt P98175
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 930 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RNA Binding Motif Protein 10 (RBM10) (N-Term) antibody WB Suggested Anti-RBM10 Antibody Titration: 1.4ug/ml
ELISA Titer: 1:62500
Positive Control: Daudi cell lysate
anti-RNA Binding Motif Protein 10 (RBM10) (N-Term) antibody (2) anti-RNA Binding Motif Protein 10 (RBM10) (N-Term) antibody (Image 2)
anti-RNA Binding Motif Protein 10 (RBM10) (N-Term) antibody (3) anti-RNA Binding Motif Protein 10 (RBM10) (N-Term) antibody (Image 3)
Background publications Thiselton, McDowall, Brandau et al.: "An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders." in: Genomics, Vol. 79, Issue 4, pp. 560-72, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182333
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top