Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182500

Retina and Anterior Neural Fold Homeobox (RAX) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AV120107, PRK, Pact, RAX, lear, dyt16, pact, prkra-a, prkra-b, rax, rbpa, Rx, RX, MCOP3, ey1, ey-1, 7530406A22Rik, E130303K03Rik, CG10052, DRx, Dmel\\CG10052, Drx, E97, PPH17, W60, bk50, drx, wom, RAX ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182500
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAX antibody: synthetic peptide directed towards the N terminal of human RAX
Sequence EYEAPRPYCPKEPWEARPSPGLPVGPATGEAKLSEEEQPK KKHRRNRTTF
Predicted Reactivity Dog : 92%, Guinea pig : 85%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against RAX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RAX
Background Retinal Homeobox Protein Rx (RAX) is a member of homeobox family of transcription factors. Mutations mouse and fish RAX lead to defects in retinal development and result in animal models of anophthalmia.
Molecular Weight 37kDa
Gene ID 30062
NCBI Accession NP_038463, NM_013435
UniProt Q9Y2V3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Voronina, Kozhemyakina, OKernick et al.: "Mutations in the human RAX homeobox gene in a patient with anophthalmia and sclerocornea." in: Human molecular genetics, Vol. 13, Issue 3, pp. 315-22, 2004 (PubMed).

Alternatives for antigen "Retina and Anterior Neural Fold Homeobox (RAX)", type "Antibodies"
Hosts (16), (10), (1)
Reactivities (26), (4), (4), (2), (2), (1), (1)
Applications (27), (13), (7), (4), (3)
Epitopes (8), (5), (4), (2), (2), (1)
Beacon