Did you know that you can buy products from over 140 different suppliers from us?

Retina and Anterior Neural Fold Homeobox (RAX) (N-Term) antibody

Details for Product No. ABIN182500
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AV120107, PRK, Pact, RAX, lear, dyt16, pact, prkra-a, prkra-b, rax, rbpa, Rx, RX, MCOP3, ey1, ey-1, 7530406A22Rik, E130303K03Rik, CG10052, DRx, Dmel\\CG10052, Drx, E97, PPH17, W60, bk50, drx, wom, RAX ... show more
AV120107, PRK, Pact, RAX, lear, dyt16, pact, prkra-a, prkra-b, rax, rbpa, Rx, RX, MCOP3, ey1, ey-1, 7530406A22Rik, E130303K03Rik, CG10052, DRx, Dmel\\CG10052, Drx, E97, PPH17, W60, bk50, drx, wom, RAXL, RX1, RX2, Rx-like, cRax1, cRaxL, rx, rx1, Rx2A, Xrax, Xrx1 show less
Epitope
N-Term
(13), (5), (4), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Dog (Canine), Human
(30), (4), (3), (2), (1), (1)
Host
Rabbit
(20), (10), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (19), (11), (4), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182500
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RAX
Sequence EYEAPRPYCPKEPWEARPSPGLPVGPATGEAKLSEEEQPK KKHRRNRTTF
Predicted Reactivity Dog : 92 %, Guinea pig : 82 %, Rat : 72 %
Characteristics This is a rabbit polyclonal antibody against RAX. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RAX
Background Retinal Homeobox Protein Rx (RAX) is a member of homeobox family of transcription factors. Mutations mouse and fish RAX lead to defects in retinal development and result in animal models of anophthalmia.
Molecular Weight 37 kDa
Gene ID 30062
NCBI Accession NM_013435, NP_038463
UniProt Q9Y2V3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 346 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Retina and Anterior Neural Fold Homeobox (RAX) (N-Term) antibody WB Suggested Anti-RAX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Voronina, Kozhemyakina, OKernick et al.: "Mutations in the human RAX homeobox gene in a patient with anophthalmia and sclerocornea." in: Human molecular genetics, Vol. 13, Issue 3, pp. 315-22, 2004 (PubMed).

Hosts (20), (10), (1)
Reactivities (30), (4), (3), (2), (1), (1)
Applications (30), (19), (11), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (13), (5), (4), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182500
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top