Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Sirtuin 1 (SIRT1) antibody

Antigen

Sirtuin 1 (SIRT1)

Synonyms SIR2L1, SIRT1, SIR2, sirtuin 1, SRT1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis, Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN182554
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SIRT1
Gene ID SIRT1
UniProt Q96EB6
Immunogen The immunogen for anti-SIRT1 antibody: synthetic peptide directed towards the N terminal of human SIRT1
Sequence PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDA VKLLQECKKI
Cross-Reactivity Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SIRT1 antibody concentration is 1 mg/ml.
Description SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined,
Characteristics Antigen Size: 747 amino acids
Molecular Weight 82kDa

Application Details

Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Apoptosis/Necrosis, Proteases
Restrictions For Research Use only

Publications

Product Solomon, Pasupuleti, Xu et al.: "Inhibition of SIRT1 catalytic activity increases p53 acetylation but does not alter cell survival following DNA damage." in: Molecular and cellular biology, Vol. 26, Issue 1, pp. 28-38, 2005 (PubMed).

Anavekar, Mirza, Skali et al.: "Risk assessment in patients with depressed left ventricular function after myocardial infarction using the myocardial performance index--Survival and Ventricular Enlargement (SAVE) experience." in: Journal of the American Society of Echocardiography : official publication of the American Society of Echocardiography, Vol. 19, Issue 1, pp. 28-33, 2006 (PubMed).

Alternatives

Alternatives for antigen "Sirtuin 1 (SIRT1)", type "Antibodies"
Hosts Rabbit (80), Mouse (11), Chicken (3), Goat (3)
Reactivities Human (74), Mouse (Murine) (42), Horse (Equine) (36), Rat (Rattus) (28), Dog (Canine) (25), Pig (Porcine) (23), Chicken (19), Cow (Bovine) (19), Monkey (2), Cat (Feline) (1)
Applications Western Blotting (WB) (53), Immunofluorescence (IF) (48), ELISA (40), Immunohistochemistry (IHC) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (15), Immunoprecipitation (IP) (8), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Flow Cytometry (FACS) (3), Immunocytochemistry (ICC) (3), Immunoelectron Microscopy (IEM) (2)
Conjugates Biotin (5), Alexa Fluor 350 (4), Alexa Fluor 488 (4), Alexa Fluor 555 (4), Alexa Fluor 647 (4), FITC (4), PE,Cy5.5 (4), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), Gold (2), HRP (2), PE (2), PE,Cy3 (2), PE,Cy5 (2), PE,Cy7 (2)
Epitopes N-Term (10), C-Term (4), pSer27 (4), pSer47 (4), AA 551-599 (1), AA 577-590 (1), AA 646-660 (1), Center (1), pSer171 (1), pSer257 (1)