TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) antibody

Antigen: TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182562

Additional Information

Alternative name: TAB2 / MAP3K7IP2

Gene ID: MAP3K7IP2

UniProt: Q9NYJ8

Immunogen: The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2

Sequence: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGE GDLNFSDDSG

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-MAP3K7IP2 antibody concentration is 1 mg/ml.

Description: MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.

Characteristics: Antigen Size: 693 amino acids

Molecular Weight: 76kDa

Application Details

Application Notes: WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) antibody (Image 2)

anti-TGF-beta Activated Kinase 1/MAP3K7 Binding Protein 2 (TAB2) antibody (Image 3)

Publications

Product: Kanayama, Seth, Sun et al.: "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains." in: Molecular cell, Vol. 15, Issue 4, pp. 535-48, 2004 (PubMed).