Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182569

Basic Helix-Loop-Helix Family, Member E22 (BHLHE22) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Beta3.1, bhlhb5, wu:fq25e11, zgc:64225, Bhlhb5, MGC145865, BHLHE22
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182569
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BHLHB5 antibody: synthetic peptide directed towards the N terminal of human BHLHB5
Sequence LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCEL VLRAGVADPR
Predicted Reactivity Golden hamster :100%,   Green puffer :100%,   Chicken :100%,   Zebrafish :100%,   Mouse :100%,   Human :100%,   Western clawed frog :93%,   Rat :92%,   Bovine :92%,  
Characteristics This is a rabbit polyclonal antibody against BHLHB5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name BHLHB5
Background BHLHB5 is a member of family of basic helix-loop-helix (bHLH) transcription factors. Members of this family have been implicated in many aspects of neural development, including cell growth, differentiation, and cell migration.
Molecular Weight 37kDa
Gene ID 27319
NCBI Accession NP_689627, NM_152414
UniProt Q8NFJ8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BHLHB5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Mechanisms of development, Vol. 119 Suppl 1, pp. S285-91, 2003 (PubMed).

Alternatives for antigen "Basic Helix-Loop-Helix Family, Member E22 (BHLHE22)", type "Antibodies"
Hosts (21)
Reactivities (21), (15), (15), (13), (13), (12), (12), (3)
Applications (11), (10), (4), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1), (1)
Beacon