Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182633

Heat Shock Transcription Factor 4 (HSF4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSF 4, HSTF 4, HSTF4, ldis1, mHSF4, CTM, CTRCT5
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN182633
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HSF4 antibody: synthetic peptide directed towards the middle region of human HSF4
Sequence VTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLSL MLDEGSSCPT
Predicted Reactivity Human : 100%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against HSF4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name HSF4
Background Heat-shock transcription factors (HSFs) activate heat-shock response genes under conditions of heat or other stresses. HSF4 lacks the carboxyl-terminal hydrophobic repeat which is shared among all vertebrate HSFs and has been suggested to be involved in the negative regulation of DNA binding activity. Two alternatively spliced transcripts encoding distinct isoforms and possessing different transcriptional activity have been described.
Molecular Weight 50kDa
Gene ID 3299
NCBI Accession NP_001529, NM_001538
UniProt Q9ULV5-2
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HSF4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Heat Shock Transcription Factor 4 (HSF4)", type "Antibodies"
Hosts (14), (11), (1)
Reactivities (25), (3)
Applications (26), (17), (3), (2), (1), (1), (1), (1), (1)
Epitopes (6), (4), (2), (2), (2), (2), (1), (1), (1)
Beacon