High-Mobility Group 20A (HMG20A) (Middle Region) antibody

Details for Product No. ABIN182661
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fe47h11, wu:fe47h11, zgc:162335, hmg20a, MGC82871, MGC89476, HMGX1, HMGXB1, 1200004E06Rik, 5730490E10Rik, Hmgxb1, Ibraf, RGD1564760
Epitope
Middle Region
(7), (4), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(32), (10), (9), (6), (6), (2), (1)
Host
Rabbit
(18), (7), (7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(23), (14), (6), (6), (3), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182661
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HMG20A
Sequence RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPI FTEEFLNHSK
Predicted Reactivity Dog : 100 %, Horse : 100 %, Rat : 100 %, Bovine : 90 %, Pig : 90 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against HMG20A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name HMG20A
Background HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4
Molecular Weight 40 kDa
Gene ID 10363
NCBI Accession NM_018200, NP_060670
UniProt Q9NP66
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 347 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-High-Mobility Group 20A (HMG20A) (Middle Region) antibody anti-High-Mobility Group 20A (HMG20A) (Middle Region) antibody
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Validation Images
back to top