Zinc Finger Protein 823 (ZNF823) (Middle Region) antibody

Details for Product No. ABIN182700
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSZFP36
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Human
(7)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182700
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HSZFP36
Sequence GKAFSLAGSLRRHEATHTGVKPYKCQCGKAFSDLSSFQNH ETTHTGEKPY
Predicted Reactivity Human :100 % Sumatran orangutan :80 %,  
Characteristics This is a rabbit polyclonal antibody against HSZFP36. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HSZFP36
Background CDNA sequence of HSZFP36 is generated by Mammalian Gene Collection (MGC) Program Team.
Molecular Weight 44 kDa
Gene ID 55552
NCBI Accession NM_001080493
UniProt Q6P4A9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 397 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (7)
Reactivities (7)
Applications (7), (1), (1)
Epitopes (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top