Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182700

Zinc Finger Protein 823 (ZNF823) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSZFP36
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182700
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HSZFP36 antibody: synthetic peptide directed towards the middle region of human HSZFP36
Sequence GKAFSLAGSLRRHEATHTGVKPYKCQCGKAFSDLSSFQNH ETTHTGEKPY
Predicted Reactivity Human :100% Sumatran orangutan :83%,  
Characteristics This is a rabbit polyclonal antibody against HSZFP36. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HSZFP36
Background CDNA sequence of HSZFP36 is generated by Mammalian Gene Collection (MGC) Program Team.
Molecular Weight 44kDa
Gene ID 55552
NCBI Accession AAH63560, NM_001080493
UniProt Q6P4A9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HSZFP36 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 823 (ZNF823)", type "Antibodies"
Hosts (7)
Reactivities (7), (1)
Applications (7), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1)
Beacon