Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182716

Zinc Finger Protein 624 (ZNF624) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF624
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN182716
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF624 antibody: synthetic peptide directed towards the middle region of human ZNF624
Sequence PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFI NYSCLTVHHR
Predicted Reactivity Bovine : 100%, Horse : 100%, Pig : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF624. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF624
Background This gene, located on chromosome 17, encodes a protein that is part of the zinc finger family.
Molecular Weight 100kDa
Gene ID 57547
NCBI Accession NP_065838, NM_020787
UniProt Q6ZN27
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF624 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Dudek, Michno, Michalski: "[Lateral lumbar disk herniation]." in: Chirurgia narzadów ruchu i ortopedia polska, Vol. 65, Issue 1, pp. 65-70, 2000 (PubMed).

Background publications Nagase, Kikuno, Ishikawa et al.: "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 7, Issue 1, pp. 65-73, 2000 (PubMed).

Alternatives for antigen "Zinc Finger Protein 624 (ZNF624)", type "Antibodies"
Hosts (6), (2)
Reactivities (8), (3), (1), (1), (1)
Applications (8), (2), (2)
Epitopes (2), (2), (1), (1)
Beacon