Zinc Finger Protein 624 (ZNF624) antibody

Antigen: Zinc Finger Protein 624 (ZNF624)

Synonyms: KIAA1349, MGC119602, MGC119603, MGC119605, ZNF624

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN182716

Additional Information

Alternative name: ZNF624

Gene ID: ZNF624

UniProt: Q6ZN27

Immunogen: The immunogen for anti-ZNF624 antibody: synthetic peptide directed towards the middle region of human ZNF624

Sequence: PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFI NYSCLTVHHR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF624 antibody concentration is 1 mg/ml.

Description: This gene, located on chromosome 17, encodes a protein that is part of the zinc finger family.

Characteristics: Antigen Size: 865 amino acids

Molecular Weight: 100kDa

Application Details

Application Notes: WB Suggested Anti-ZNF624 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF624 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Nagase, Kikuno, Ishikawa et al.: "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." in: DNA research : an international journal for rapid publication of reports on genes and genomes, Vol. 7, Issue 1, pp. 65-73, 2000 (PubMed).

Dudek, Michno, Michalski: "[Lateral lumbar disk herniation]." in: Chirurgia narzadów ruchu i ortopedia polska, Vol. 65, Issue 1, pp. 65-70, 2000 (PubMed).