Prenylcysteine Oxidase 1 (PCYOX1) antibody

Antigen: Prenylcysteine Oxidase 1 (PCYOX1)

Synonyms: PCL1, KIAA0908, Pcly, AI115532, AI448340, 1200015P13Rik, Clp55, PCYOX1, pcyox1, zgc:110246, MGC157353, DKFZp459K115

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN182725

Additional Information

Alternative name: PCYOX1

Gene ID: PCYOX1

UniProt: Q9UHG3

Immunogen: The immunogen for anti-PCYOX1 antibody: synthetic peptide directed towards the C terminal of human PCYOX1

Sequence: IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCP SIILHDRLYY

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-PCYOX1 antibody concentration is 1 mg/ml.

Description: Prenylated proteins contain one of two isoprenoid lipids, either the 15-carbon farnesyl or the 20-carbon geranylgeranyl, covalently attached to cysteine residues at or near their C terminus. PCYOX1 is capable of cleaving the thioether bond of prenylcysteines. The enzyme was isolated from bovine brain membranes and exhibits an apparent molecular mass of 63 kDa. This is a specific enzyme involved in prenylcysteine metabolism in mammalian cells, most likely comprising the final step in the degradation of prenylated proteins.

Characteristics: Antigen Size: 505 amino acids

Molecular Weight: 57kDa

Application Details

Application Notes: WB Suggested Anti-PCYOX1 Antibody Titration: 0.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-PCYOX1 Antibody Titration: 0.5ug/ml
Positive Control: Jurkat cell lysate

anti-Prenylcysteine Oxidase 1 (PCYOX1) antibody (Image 2)

Publications

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).