Zinc Finger Protein 654 (ZNF654) (Middle Region) antibody

Details for Product No. ABIN182748
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RGD1308321, Znf654, 1600021C16Rik, 1810008K20Rik, ZNF654, zfp654
Epitope
Middle Region
(2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(6), (1)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(6), (1)
Pubmed 1 reference available
Catalog no. ABIN182748
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF654
Sequence TKSHRTFQAQCSFPECHELFEDLPLLYEHEAQHYLSKTPE SSAQPSETIL
Predicted Reactivity Rat :100 %,   Dog :100 %,   Human :100 %,   Mouse :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF654. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name ZNF654
Background The ZNF654 gene, located on chromosome 17, encodes a protein that is part of the zinc finger family.
Molecular Weight 33 kDa
Gene ID 55279
NCBI Accession NM_018293, NP_060763
UniProt Q9NV14
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 299 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 654 (ZNF654) (Middle Region) antibody anti-Zinc Finger Protein 654 (ZNF654) (Middle Region) antibody
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (6)
Reactivities (6), (1)
Applications (6), (1)
Epitopes (2), (2), (2), (1), (1)
back to top