Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 24 (ZNF24) (Middle Region) antibody

Details for Product No. ABIN182823
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191, 3526401F17Rik, 5033419P20Rik, AI480505, AI642085, AL024422, ZF-12, Znf191, Znf24, Znp191
Epitope
Middle Region
(8), (7), (5), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
(37), (11), (11)
Host
Rabbit
(29), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(35), (21), (4), (4), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182823
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF24
Sequence CDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFK YGETCFPKGR
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rat : 100 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against ZNF24. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name ZNF24
Background ZNF24 is a new candidate transcription factor.
Molecular Weight 42 kDa
Gene ID 7572
NCBI Accession NM_006965, NP_008896
UniProt P17028
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 368 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 24 (ZNF24) (Middle Region) antibody WB Suggested Anti-ZNF24 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
anti-Zinc Finger Protein 24 (ZNF24) (Middle Region) antibody (2) anti-Zinc Finger Protein 24 (ZNF24) (Middle Region) antibody (Image 2)
Background publications Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182823
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top