Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182823

Zinc Finger Protein 24 (ZNF24) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191, 3526401F17Rik, 5033419P20Rik, AI480505, AI642085, AL024422, ZF-12, Znf191, Znf24, Znp191
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182823
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF24 antibody: synthetic peptide directed towards the middle region of human ZNF24
Sequence CDDDGRTENGALAPKQELPSALESHEVPGTLSMGVPQIFK YGETCFPKGR
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rat : 100%, Mouse : 91%
Characteristics This is a rabbit polyclonal antibody against ZNF24. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name ZNF24
Background ZNF24 is a new candidate transcription factor.
Molecular Weight 42kDa
Gene ID 7572
NCBI Accession NP_008896, NM_006965
UniProt P17028
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF24 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).

Alternatives for antigen "Zinc Finger Protein 24 (ZNF24)", type "Antibodies"
Hosts (17), (8)
Reactivities (25), (9), (9)
Applications (23), (14), (4), (3), (2), (2), (1)
Epitopes (5), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon