Did you know that you can buy products from over 140 different suppliers from us?

FLJ13798 (FLJ13798) (C-Term) antibody

Details for Product No. ABIN182843
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182843
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FLJ13798
Sequence YPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPG EILFIPVKYW
Predicted Reactivity Human :100 %,   Mouse :100 %,   Rat :100 %,   Bovine :100 %,   Caenorhabditis elegans :100 %,   Caenorhabditis vulgaris :100 %,   Uncultured organism :100 %,   Dog :90 %,   Florida lancelet :90 %,   Caenorhabditis briggsae :90 %,   Zebrafish :80 %,   Black-legged tick :80 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ13798. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FLJ13798
Background The FLJ13798 gene, located on chromosome 16, encodes a hypothetical protein with unknown function.
Molecular Weight 47 kDa
Gene ID 79831
NCBI Accession NM_024773, NP_079049
UniProt Q9H8B1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 416 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Validation Images
back to top