Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182843

FLJ13798 (FLJ13798) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182843
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ13798 antibody: synthetic peptide directed towards the C terminal of human FLJ13798
Sequence YPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPG EILFIPVKYW
Predicted Reactivity Human :100%,   Mouse :100%,   Rat :100%,   Bovine :100%,   Caenorhabditis elegans :100%,   Caenorhabditis vulgaris :100%,   Uncultured organism :100%,   Dog :92%,   Florida lancelet :91%,   Caenorhabditis briggsae :90%,   Zebrafish :84%,   Black-legged tick :84%,  
Characteristics This is a rabbit polyclonal antibody against FLJ13798. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FLJ13798
Background The FLJ13798 gene, located on chromosome 16, encodes a hypothetical protein with unknown function.
Molecular Weight 47kDa
Gene ID 79831
NCBI Accession NP_079049, NM_024773
UniProt Q9H8B1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ13798 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "FLJ13798 (FLJ13798)", type "Antibodies"
Hosts (1)
Reactivities (1)
Applications (1)
Beacon