FLJ13798 (FLJ13798) (C-Term) antibody

Details for Product No. ABIN182843
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Catalog no. ABIN182843
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FLJ13798
Sequence YPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPG EILFIPVKYW
Predicted Reactivity Human :100 %,   Mouse :100 %,   Rat :100 %,   Bovine :100 %,   Caenorhabditis elegans :100 %,   Caenorhabditis vulgaris :100 %,   Uncultured organism :100 %,   Dog :90 %,   Florida lancelet :90 %,   Caenorhabditis briggsae :90 %,   Zebrafish :80 %,   Black-legged tick :80 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ13798. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FLJ13798
Background The FLJ13798 gene, located on chromosome 16, encodes a hypothetical protein with unknown function.
Molecular Weight 47 kDa
Gene ID 79831
NCBI Accession NM_024773, NP_079049
UniProt Q9H8B1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 416 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (1)
Reactivities (1)
Applications (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top