Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182844

Zinc Finger Protein 212 (ZNF212) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C2H2-150, ZNF182, ZNFC150, Znf212, mKIAA3011
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182844
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF212 antibody: synthetic peptide directed towards the C terminal of human ZNF212
Sequence EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCG KSFSHPSDLV
Predicted Reactivity Human : 100%, Dog : 85%, Horse : 85%, Rabbit : 84%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against ZNF212. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF212
Background ZNF212 belongs to the C2H2-type zinc finger gene family. The zinc finger proteins are involved in gene regulation and development, and are quite conserved throughout evolution. Like this gene product, a third of the zinc finger proteins containing C2H2 fingers also contain the KRAB domain, which has been found to be involved in protein-protein interactions.
Molecular Weight 55kDa
Gene ID 7988
NCBI Accession NP_036388, NM_012256
UniProt Q9UDV6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF212 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 212 (ZNF212)", type "Antibodies"
Hosts (8)
Reactivities (8), (2), (2)
Applications (8)
Epitopes (6), (2), (1), (1)
Beacon