Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182940

Tripartite Motif Containing 13 (TRIM13) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CAR, LEU5, RFP2, DLEU5, RNF77, Rfp2, 3110001L12Rik, TRIM13
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182940
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RFP2 antibody: synthetic peptide directed towards the middle region of human RFP2
Sequence KVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEIN KLNTILQEQR
Predicted Reactivity Mouse :100%,   Rat :100%,   Sumatran orangutan :100%,   Human :100%,   Bovine :92%,  
Characteristics This is a rabbit polyclonal antibody against RFP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RFP2
Background The protein encoded by RFP2 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies near the nucleus, but its function is unknown. RFP2 is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia.
Molecular Weight 45kDa
Gene ID 10206
NCBI Accession NP_434698, NM_052811
UniProt O60858
Research Area Chromatin and Nuclear Signaling, Cell Cycle, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RFP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 13 (TRIM13)", type "Antibodies"
Hosts (25), (3)
Reactivities (28), (13), (13), (11), (11), (2)
Applications (17), (11), (9), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (2), (2), (2), (1)
Beacon