Did you know that you can buy products from over 140 different suppliers from us?

FLJ20729 (C-Term) antibody

Details for Product No. ABIN183040
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
Reactivity
Dog (Canine), Mouse (Murine), Human, Chicken
Host
Rabbit
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183040
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FLJ20729
Sequence PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDK KKQQFCWHVK
Predicted Reactivity Human :100 %,   Dog :100 %,   Sumatran orangutan :100 %,   Chicken :80 %,   Moss :80 %,   Mouse :80 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ20729. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Background TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase
Molecular Weight 54 kDa
Gene ID 54680
NCBI Accession NM_017953, NP_060423
UniProt Q9NWN0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 470 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ20729 (C-Term) antibody WB Suggested Anti-FLJ20729 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-FLJ20729 (C-Term) antibody (2) anti-FLJ20729 (C-Term) antibody (Image 2)
General Scanlan, Gout, Gordon et al.: "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression." in: Cancer immunity, Vol. 1, pp. 4, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183040
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top