Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183040

FLJ20729 (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
Reactivity
Dog (Canine), Mouse (Murine), Human, Chicken
Host
Rabbit
Clonality Polyclonal
Application
Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183040
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ20729 antibody: synthetic peptide directed towards the C terminal of human FLJ20729
Sequence PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDK KKQQFCWHVK
Predicted Reactivity Human :100%,   Dog :100%,   Sumatran orangutan :100%,   Chicken :85%,   Moss :83%,   Mouse :83%,  
Characteristics This is a rabbit polyclonal antibody against FLJ20729. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Background TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase
Molecular Weight 54kDa
Gene ID 54680
NCBI Accession NP_060423, NM_017953
UniProt Q9NWN0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ20729 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Scanlan, Gout, Gordon et al.: "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression." in: Cancer immunity, Vol. 1, pp. 4, 2003 (PubMed).

Beacon