Did you know that you can buy products from over 140 different suppliers from us?

FLJ20729 (C-Term) antibody

Details for Product No. ABIN183040
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
C-Term
Reactivity
Dog (Canine), Mouse (Murine), Human, Chicken
Host
Rabbit
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183040
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FLJ20729
Sequence PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDK KKQQFCWHVK
Predicted Reactivity Human :100 %,   Dog :100 %,   Sumatran orangutan :100 %,   Chicken :80 %,   Moss :80 %,   Mouse :80 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ20729. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Background TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase
Molecular Weight 54 kDa
Gene ID 54680
NCBI Accession NM_017953, NP_060423
UniProt Q9NWN0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 470 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ20729 (C-Term) antibody WB Suggested Anti-FLJ20729 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-FLJ20729 (C-Term) antibody (2) anti-FLJ20729 (C-Term) antibody (Image 2)
General Scanlan, Gout, Gordon et al.: "Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression." in: Cancer immunity, Vol. 1, pp. 4, 2003 (PubMed).

Validation Images
back to top