Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183041

DCP1 Decapping Enzyme Homolog A (S. Cerevisiae) (DCP1A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSA275986, Nbla00360, SMAD4IP1, SMIF, Mitc1, AU019772, D14Ertd817e, 1110066A22Rik, 4930568L04Rik, RGD1561298, mitc1, smad4ip1, smif, DCP1A
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183041
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A
Sequence EEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLD SEEMERLPGD
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Horse : 92%
Characteristics This is a rabbit polyclonal antibody against DCP1A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name DCP1A
Background Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.
Molecular Weight 56kDa
Gene ID 55802
NCBI Accession NP_060873, NM_018403
UniProt Q9NPI6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DCP1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives for antigen "DCP1 Decapping Enzyme Homolog A (S. Cerevisiae) (DCP1A)", type "Antibodies"
Hosts (33), (12), (6)
Reactivities (49), (26), (15), (13), (13), (12), (1), (1), (1)
Applications (39), (26), (10), (4), (3), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (4), (2), (2), (1), (1), (1)
Beacon