Did you know that you can buy products from over 140 different suppliers from us?

LAS1-Like (S. Cerevisiae) (LAS1L) (Middle Region) antibody

Details for Product No. ABIN183053
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Las1-like, dJ475B7.2, RGD1565755, 1810030A06Rik, 5830482G23Rik
Epitope
Middle Region
(9), (7), (2), (1), (1)
Reactivity
Human
(16), (2), (2)
Host
Rabbit
(14), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (8), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183053
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for Anti-LAS1L antibody is: synthetic peptide directed towards the middle region of Human LAS1L
Sequence SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEE ENDDQEEEEE
Predicted Reactivity Human : 100 %, Horse : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against LAS1L. It was validated on Western Blot.
Purification Affinity Purified
Alternative Name LAS1L
Background The function of LAS1L has not been determined.
Molecular Weight 83 kDa
Gene ID 81887
NCBI Accession NM_031206, NP_112483
UniProt Q9Y4W2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 734 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-LAS1-Like (S. Cerevisiae) (LAS1L) (Middle Region) antibody WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Product cited in: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183053
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top