Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183053

LAS1-Like (S. Cerevisiae) (LAS1L) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Las1-like, dJ475B7.2, RGD1565755, 1810030A06Rik, 5830482G23Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183053
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for Anti-LAS1L antibody is: synthetic peptide directed towards the middle region of Human LAS1L
Sequence SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEE ENDDQEEEEE
Predicted Reactivity Human : 100%, Horse : 80%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against LAS1L. It was validated on Western Blot. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name LAS1L
Background The function of LAS1L has not been determined.
Molecular Weight 83kDa
Gene ID 81887
NCBI Accession NP_112483, NM_031206
UniProt Q9Y4W2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final Anti-LAS1L antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "LAS1-Like (S. Cerevisiae) (LAS1L)", type "Antibodies"
Hosts (8), (2)
Reactivities (10), (2), (2)
Applications (10), (2), (2)
Epitopes (6), (2), (2), (1)
Beacon