Did you know that you can buy products from over 140 different suppliers from us?

Tripartite Motif Containing 14 (TRIM14) (N-Term) antibody

Details for Product No. ABIN183075
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms pub, 5830400N10Rik, TRIM14
Epitope
N-Term
(3), (3), (3), (3)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(15), (1), (1)
Host
Rabbit
(13), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183075
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRIM14
Sequence TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQL DIMNDLSNRV
Predicted Reactivity Human : 100 %, Bovine : 90 %, Horse : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Dog : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against TRIM14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM14
Background The protein encoded byTRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.
Molecular Weight 28 kDa
Gene ID 9830
NCBI Accession NM_033221, NP_150090
UniProt Q5TBQ8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 253 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 14 (TRIM14) (N-Term) antibody WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Hosts (13), (2)
Reactivities (15), (1), (1)
Applications (15), (3), (2), (2), (2), (1)
Epitopes (3), (3), (3), (3)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183075
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top