Homeobox A1 (HOXA1) antibody

Antigen: Homeobox A1 (HOXA1)

Synonyms: bsas, hox1f, xhoxa1, hoxa1-A, Xhox.lab, xhox.lab2, HOXA2, HOXA1, hox1, MGC79507, HOXD1, BSAS, HOX1, HOX1F, MGC45232, ERA1, Hox-1.6

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Rabbit

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183082

Additional Information

Alternative name: HOXA1 / HOX1F

Gene ID: HOXA1

UniProt: P49639-2

Immunogen: The immunogen for anti-HOXA1 antibody: synthetic peptide directed towards the middle region of human HOXA1

Sequence: NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADPPRSLS LPRIGDIFSS

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-HOXA1 antibody concentration is 1 mg/ml.

Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA1 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development.

Characteristics: Antigen Size: 132 amino acids

Molecular Weight: 14kDa

Application Details

Application Notes: WB Suggested Anti-HOXA1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purity: Rabbit IgG purified by protein A chromatography

Purification: Protein A purified

Buffer: PBS

Storage: Antibody is lyophilized from PBS buffer with 2% sucrose. Add 100 µl of distilled water. Final antibody concentration is 1 mg/ml. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HOXA1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

anti-Homeobox A1 (HOXA1) antibody (Image 2)

Publications

Product: Conciatori, Stodgell, Hyman et al.: "Association between the HOXA1 A218G polymorphism and increased head circumference in patients with autism." in: Biological psychiatry, Vol. 55, Issue 4, pp. 413-9, 2004 (PubMed).