Zinc Finger Protein 568 (ZNF568) (N-Term) antibody

Details for Product No. ABIN183105
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF268, ZNF568, ZNF780A, ZNF780B, ZNF793, ZNF605
Epitope
N-Term
(5), (1)
Reactivity
Cow (Bovine), Human
(18), (14), (12), (1), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN183105
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF568
Sequence SKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDSLD KGLEHNLDLL
Predicted Reactivity Human : 100 %, Horse : 90 %, Pig : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against ZNF568. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF568
Background The function of the Anti-ZNF568 gene has not yet been determined
Molecular Weight 44 kDa
Gene ID 374900
NCBI Accession NM_198539, NP_940941
UniProt Q6N060
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 377 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (18)
Reactivities (18), (14), (12), (1), (1), (1)
Applications (10), (9), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top