Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183191

Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ACCN4, BNAC4, Accn4, Spasic
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183191
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4
Sequence SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAV APGAAPRDLA
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against ACCN4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ACCN4
Background ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.
Molecular Weight 46kDa
Gene ID 55515
NCBI Accession AAH31812, NM_182847
UniProt Q96FT7-2
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ACCN4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4)", type "Antibodies"
Hosts (35)
Reactivities (31), (21), (21), (17), (17), (17)
Applications (21), (15), (10), (9), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (2), (2), (2), (1), (1)
Beacon