Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) antibody

Antigen: Interleukin Enhancer Binding Factor 2, 45kDa (ILF2)

Synonyms: NF45, MGC8391, PRO3063, ilf2, MGC53292, nf45, pro3063, MGC75701, ILF2, MGC134524, DKFZp469J1839

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN183211

Additional Information

Alternative name: ILF2

Gene ID: ILF2

UniProt: Q12905

Immunogen: The immunogen for anti-ILF2 antibody: synthetic peptide directed towards the C terminal of human ILF2

Sequence: HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPP EKKEGEEEEE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ILF2 antibody concentration is 1 mg/ml.

Description: Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.

Characteristics: Antigen Size: 390 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-ILF2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ILF2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Sample Type: MCF-7 WT a whole cell lysates (110UG)
Primary Dilution: 1.5mg/mL
Secondary Antibody: LI-COR Donkey anti-rabbit
Secondary Dilution: 1:10,000

anti-Interleukin Enhancer Binding Factor 2, 45kDa (ILF2) antibody (Image 3)

Publications

Product: Shin, Kim, Cho et al.: "Host cell proteins binding to the encapsidation signal epsilon in hepatitis B virus RNA." in: Archives of virology, Vol. 147, Issue 3, pp. 471-91, 2002 (PubMed).