Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183247

Vestigial Like 1 (Drosophila) (VGLL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TDU, VGL1, RGD1564038, Tondu, VGLL1, vgl1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183247
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-VGLL1 antibody: synthetic peptide directed towards the N terminal of human VGLL1
Sequence LFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVM LKNDDSMSPN
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against VGLL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name VGLL1
Background VGLL1 is a specific coactivator for the mammalian TEFs. The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed.
Molecular Weight 29kDa
Gene ID 51442
NCBI Accession NP_057351, NM_016267
UniProt Q99990
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-VGLL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Vaudin, Delanoue, Davidson et al.: "TONDU (TDU), a novel human protein related to the product of vestigial (vg) gene of Drosophila melanogaster interacts with vertebrate TEF factors and substitutes for Vg function in wing formation." in: Development (Cambridge, England), Vol. 126, Issue 21, pp. 4807-16, 1999 (PubMed).

Alternatives for antigen "Vestigial Like 1 (Drosophila) (VGLL1)", type "Antibodies"
Hosts (19), (4)
Reactivities (22), (2)
Applications (14), (10), (7), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon