Did you know that you can buy products from over 140 different suppliers from us?

Gap Junction Protein, epsilon 1, 29kDa (GJE1) (C-Term) antibody

Details for Product No. ABIN183376
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GJC3, GJE1, AEY12, Cx23, D230044M03Rik, Gjf1, Gsfaey12, CX23
Epitope
C-Term
(8), (8), (1)
Reactivity
Human
(9)
Host
Rabbit
(10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183376
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GJE1
Sequence KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQE KQRPVGPRDA
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against GJE1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name GJE1
Background GJE1 is a protein component of GAP junction
Molecular Weight 31 kDa
Gene ID 349149
NCBI Accession NM_181538, NP_853516
UniProt Q8NFK1
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 279 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Gap Junction Protein, epsilon 1, 29kDa (GJE1) (C-Term) antibody WB Suggested Anti-GJE1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Validation Images
back to top