Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183376

Gap Junction Protein, epsilon 1, 29kDa (GJE1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CX23, GJC3, GJE1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183376
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GJE1 antibody: synthetic peptide directed towards the C terminal of human GJE1
Sequence KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQE KQRPVGPRDA
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against GJE1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name GJE1
Background GJE1 is a protein component of GAP junction
Molecular Weight 31kDa
Gene ID 349149
NCBI Accession NP_853516, NM_181538
UniProt Q8NFK1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GJE1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Gap Junction Protein, epsilon 1, 29kDa (GJE1)", type "Antibodies"
Hosts (6), (1)
Reactivities (4), (2)
Applications (6), (1)
Epitopes (3), (2), (2), (1)
Beacon