GJE1 antibody (C-Term)

Catalog No. ABIN630271

Product Details anti-GJE1 Antibody

Target: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJE1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJE1 antibody was raised against the C terminal of GJE1

Purification: Purified

Immunogen: GJE1 antibody was raised using the C terminal of GJE1 corresponding to a region with amino acids KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJE1 Blocking Peptide, catalog no. 33R-4739, is also available for use as a blocking control in assays to test for specificity of this GJE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJE1

Target: GJE1 (Gap Junction Protein, epsilon 1 (GJE1))

Alternative Name: GJE1 (GJE1 Products)

Synonyms: AEY12 antibody, Cx23 antibody, D230044M03Rik antibody, Gjf1 antibody, Gsfaey12 antibody, CX23 antibody, RGD1308189 antibody, gap junction protein, epsilon 1 antibody, gap junction protein epsilon 1 antibody, Gje1 antibody, GJE1 antibody

Background: GJE1 is a protein component of GAP junction

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Sensory Perception of Sound