Did you know that you can buy products from over 140 different suppliers from us?

Poly A Specific Ribonuclease (PARN) (N-Term) antibody

Details for Product No. ABIN183492
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DAN, 1200003I18Rik, RGD1565449, zgc:56067, parn-A, xparn
Epitope
N-Term
(1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
(14), (5), (4)
Host
Rabbit
(11), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (7), (5), (3), (2), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183492
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide corresponding to a region of Mouse PARN
Sequence IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLK KHSMDFLLFQ
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against PARN. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PARN
Background PARN is an oligomeric, processive, and cap-interacting 3' exonuclease.
Molecular Weight 69 kDa
Gene ID 74108
NCBI Accession NM_028761, NP_083037
UniProt Q8VDG3
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 624 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly A Specific Ribonuclease (PARN) (N-Term) antibody WB Suggested Anti-PARN Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
Background publications Katayama, Tomaru, Kasukawa et al.: "Antisense transcription in the mammalian transcriptome...." in: Science (New York, N.Y.), Vol. 309, Issue 5740, pp. 1564-6, 2005 (PubMed).

Hosts (11), (4)
Reactivities (14), (5), (4)
Applications (15), (7), (5), (3), (2), (2), (2), (1), (1)
Epitopes (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top