Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183492

Poly A Specific Ribonuclease (PARN) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DAN, 1200003I18Rik, RGD1565449, zgc:56067, parn-A, xparn
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183492
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PARN antibody: synthetic peptide corresponding to a region of Mouse
Sequence IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLK KHSMDFLLFQ
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against PARN. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PARN
Background PARN is an oligomeric, processive, and cap-interacting 3' exonuclease.
Molecular Weight 69kDa
Gene ID 74108
NCBI Accession NP_083037, NM_028761
UniProt Q8VDG3
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PARN antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Katayama, Tomaru, Kasukawa et al.: "Antisense transcription in the mammalian transcriptome." in: Science (New York, N.Y.), Vol. 309, Issue 5740, pp. 1564-6, 2005 (PubMed).

Alternatives for antigen "Poly A Specific Ribonuclease (PARN)", type "Antibodies"
Hosts (5), (4)
Reactivities (8), (4), (3)
Applications (9), (3), (3), (2), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon